Gene Rv0554
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Supposedly involved in detoxification reactions. |
| Product | Possible peroxidase BpoC (non-haem peroxidase) |
| Comments | Rv0554, (MTCY25D10.33), len: 262 aa. Possible bpoC, peroxidase (non-haem peroxidase), equivalent to NP_302477.1|NC_002677 putative hydrolase from Mycobacterium leprae (265 aa). Also highly similar or similar to various hydrolases and peroxidases e.g. CAB38877.1|AL035707|T36181 probable hydrolase from Streptomyces coelicolor (272 aa); CAC48368.1|Y16952 putative hydrolase from Amycolatopsis mediterranei (284 aa); P29715|BPA2_STRAU non-haem bromoperoxidase bpo-a2 (bromide peroxidase) from Streptomyces aureofaciens (277 aa), FASTA scores: opt: 325, E(): 2.3e-15, (29.5% identity in 268 aa overlap); O31168|PRXC_STRAU|CPO|CPOT non-heme chloroperoxidase (chloride peroxidase) from Streptomyces aureofaciens (278 aa); etc. Also similar to M. tuberculosis non-heme haloperoxidases and epoxide hydrolases e.g. Rv1938, Rv3617, etc. |
| Functional category | - |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 645467 | 646255 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0554|bpoC
VINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVKA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant