Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved transmembrane protein
CommentsRv0556, (MTCY25D10.35), len: 171 aa. Probable conserved transmembrane protein, equivalent to NP_302479.1|NC_002677 putative membrane protein from Mycobacterium leprae (175 aa). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS647959648474+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv0556|647959-648474|+|Rv0556|downstream:0|upstream:0
gtgatatcaccgaaacccctgctgcacatcctgattcatgggctcagtgatgaactgcccgatactcgaggcaggatcgtgctgcgctggttacgaatcgccgtcctgatagtgaccggtttggtcacgctgcagtcggtgcttctggtggctggtgcgtggcgcaatgacattgcgatccaacgtaatatgggggtcgcgcaggctgaggtgctcagcgccgggccgcggcgttcgacgatcgagtttgtcacaccggatcggatcacctatcggccgcaactcggtgtgctgtatccgtccgaattatccacgggcatgcgaatttacgttgagtacaacaagagggatcccaacctggtcagagtgcagcaccgtaacgccggactggcgatcatcccggccgggtccatcgcggtggtggcctggctgatcgccgccgccgcgctggtcgtgctagcggtgctggacaagcggttggaacgtcgtgaaaattcggcgtctgcaacgggctga
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0556|Rv0556
VISPKPLLHILIHGLSDELPDTRGRIVLRWLRIAVLIVTGLVTLQSVLLVAGAWRNDIAIQRNMGVAQAEVLSAGPRRSTIEFVTPDRITYRPQLGVLYPSELSTGMRIYVEYNKRDPNLVRVQHRNAGLAIIPAGSIAVVAWLIAAAALVVLAVLDKRLERRENSASATG