Gene Rv0590A in Mycobacterium tuberculosis H37Rv
Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
Gene summary information
Gene nameRv0590A
Gene length255 bp
IdentifierRv0590A
Location 688808 bp
Protein summary information
Molecular mass9180.56 Da
Isoelectric point6.7753
Protein length84 amino acids
Orthologues
M. bovisMb0605
Cross-references
UniProtI6X9D2
TB databaseRv0590A
Interacting Drugs/Compounds
TDR TargetsLink
Precomputed results
BLASTReport
General annotation
TypeCDS
FunctionUnknown, but could be involved in host cell invasion.
ProductMce-family related protein
CommentsRv0590A, len: 84 aa. Probable continuation of mce2B|Rv0590. Can find no frameshift to account for this. Possible nucleotide G missing at 688793 as there are 5 in Mycobacterium bovis but only 4 in CDC1551. Strong similarity to C-terminus of other Mce proteins e.g. AL583926|AL583926_38 from Mycobacterium leprae strain tn (346 aa), FASTA scores: E(): 1.2e-20, (67.85% identity in 84 aa overlap).
Functional categoryVirulence, detoxification, adaptation
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). M. tuberculosis H37Rv Rv0587-Rv0594 mutant growth in liquid broth, RAW macrophages, and C57BL/6 mouse lungs is comparable to wild-type; RAW macrophages infected with mutant produce less TNF-alpha and IL-6 than with wild-type; C57BL/6 mice infected with mutant live longer than those infected with wild-type; lung pathology in C57BL/6 mice infected with mutant is reduced compared to wild-type (See Marjanovic et al., 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS688808689062+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0590A|Rv0590A
LLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAGGIYGDFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRCTPQ
Bibliography