Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown, but could be involved in host cell invasion.
ProductMce-family related protein
CommentsRv0590A, len: 84 aa. Probable continuation of mce2B|Rv0590. Can find no frameshift to account for this. Possible nucleotide G missing at 688793 as there are 5 in Mycobacterium bovis but only 4 in CDC1551. Strong similarity to C-terminus of other Mce proteins e.g. AL583926|AL583926_38 from Mycobacterium leprae strain tn (346 aa), FASTA scores: E(): 1.2e-20, (67.85% identity in 84 aa overlap).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). M. tuberculosis H37Rv Rv0587-Rv0594 mutant growth in liquid broth, RAW macrophages, and C57BL/6 mouse lungs is comparable to wild-type; RAW macrophages infected with mutant produce less TNF-alpha and IL-6 than with wild-type; C57BL/6 mice infected with mutant live longer than those infected with wild-type; lung pathology in C57BL/6 mice infected with mutant is reduced compared to wild-type (See Marjanovic et al., 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS688808689062+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0590A|Rv0590A
LLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAGGIYGDFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRCTPQ