Gene Rv0590A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown, but could be involved in host cell invasion. |
| Product | Mce-family related protein |
| Comments | Rv0590A, len: 84 aa. Probable continuation of mce2B|Rv0590. Can find no frameshift to account for this. Possible nucleotide G missing at 688793 as there are 5 in Mycobacterium bovis but only 4 in CDC1551. Strong similarity to C-terminus of other Mce proteins e.g. AL583926|AL583926_38 from Mycobacterium leprae strain tn (346 aa), FASTA scores: E(): 1.2e-20, (67.85% identity in 84 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). M. tuberculosis H37Rv Rv0587-Rv0594 mutant growth in liquid broth, RAW macrophages, and C57BL/6 mouse lungs is comparable to wild-type; RAW macrophages infected with mutant produce less TNF-alpha and IL-6 than with wild-type; C57BL/6 mice infected with mutant live longer than those infected with wild-type; lung pathology in C57BL/6 mice infected with mutant is reduced compared to wild-type (See Marjanovic et al., 2009). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 688808 | 689062 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0590A|Rv0590A
LLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAGGIYGDFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRCTPQ
Bibliography
- Marjanovic O, Miyata T, Goodridge A, Kendall LV and Riley LW [2010]. Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
