Gene Rv0596c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Possible antitoxin VapB4 |
Comments | Rv0596c, (MTCY19H5.26), len: 85 aa. Possible vapB4, antitoxin, part of toxin-antitoxin (TA) operon with Rv0595c (See Arcus et al., 2005; Pandey and Gerdes, 2005). Highly similar in part to other M. tuberculosis hypothetical proteins e.g. Rv0626, Rv3181c, Rv3385c, Rv3407, etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 695228 | 695485 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0596c|vapB4 MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW
Bibliography
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant