Gene Rv0609A
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved hypothetical protein |
Comments | Rv0609A, len: 75 aa. Conserved hypothetical protein, highly similar to part of upstream ORF Rv0612|MTCY19H5.09c conserved hypothetical protein from Mycobacterium tuberculosis (201 aa), FASTA scores: opt: 154, E(): 1.8e-05, (74.3% identity in 35 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
Functional category | Conserved hypotheticals |
Operon | Rv0609A and B55 are co-transcribed, by RT-PCR (See Arnvig and Young, 2009). |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 703830 | 704057 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0609A|Rv0609A VEGQRLWAHRRPKGTGSAVIDVSLARRCEAHGYDYFRSDDPVAAAGFVVSAVWSCGRGPGNATGSGRLPKPLRHS
Bibliography
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence