Gene Rv0618 (galT')
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in galactose metabolism (leloir pathway) [catalytic activity: UTP + alpha-D-galactose 1-phosphate = diphosphate + UDP-galactose]. |
| Product | Probable galactose-1-phosphate uridylyltransferase GalTa [first part] |
| Comments | Rv0618, (MTCY19H5.03c), len: 231 aa (probable partial CDS). Probable galTa, first part of galactose-1-phosphate uridylyltransferase, highly similar to N-terminal half of other galT proteins e.g. P13212|GAL7_STRLI galactose-1-phosphate uridylyltransferase from Streptomyces lividans (354 aa), FASTA scores: opt: 296, E(): 1.4e-11, (50.8% identity in 177 aa overlap); etc. Also highly similar to N-terminal half of some UDP glucose--hexose-1-phosphate uridylyltransferases. N-terminal 28 aa similar to MTCY20H11.08|Rv0627|MTCY20H11.08 conserved hypothetical protein from Mycobacterium tuberculosis (135 aa), FASTA score: (71.4% identity in 28 overlap). Cosmid sequence is correct but there may be a frameshift mutation in this region which would allow the two ORFs to be joined. Belongs to the galactose-1-phosphate uridylyltransferase family 1. Note that previously known as galT'. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 711536 | 712231 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0618|galTa
MSATPPPGGLDASVFIANERGRQLDEALPVGFCVVTAPTRWTLADGRDLLFFSLPGHVPAPVSDRRPLPERDPAPSRLRFDRATGQWVIVAAQRQDRTYKPPAARCPLCPGPTGLSSEVPAPDYDVVVFENRFPSLAGAGIAPIGAPDGDGFVSAPGHGRCEVICFSADHTGSFAGLDPAHARLVVHAWRHRTAELTALPGVAQVFCFENRGEEIGVTLPTRTARFTPIRI
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
