Gene Mb0635
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable galactose-1-phosphate uridylyltransferase galtb [second part] |
| Comments | Mb0635, galT, len: 394 aa. Equivalent to Rv0618 and Rv0619, len: 231 aa (probable partial CDS) and 181 aa (probable partial CDS), from Mycobacterium tuberculosis strain H37Rv, (99.5% identity in 219 aa overlap and 99.4% identity in 174 aa overlap). Rv0618: Probable galT', first part of galactose-1-phosphate uridylyltransferase (EC 2.7.7.10), highly similar to N-terminal half of other galT proteins e.g. P13212|GAL7_STRLI galactose-1-phosphate uridylyltransferase from Streptomyces lividans (354 aa),FASTA scores: opt: 296, E(): 1.4e-11, (50.8% identity in 177 aa overlap); etc. Also highly similar to N-terminal half of some UDP glucose--hexose-1-phosphate uridylyltransferases (EC 2.7.7.12). N-terminal 28 aa similar to MTCY20H11.08|Rv0627|MTCY20H11.08 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (135 aa), FASTA score: (71.4% identity in 28 aa overlap). BELONGS TO THE GALACTOSE-1-PHOSPHATE URIDYLYLTRANSFERASE >FAMILY 1. Rv0619: Probable 'galT, second part of galactose-1-phosphate uridylyltransferase (EC 2.7.7.10),highly similar to C-terminal half of other galT proteins e.g. P13212|GAL7_STRLI galactose-1-phosphate uridylyltransferase from Streptomyces lividans (354 aa),FASTA scores: opt: 416, E(): 5.2e-22, (43.0% identity in 186 aa overlap), etc. BELONGS TO THE GALACTOSE-1-PHOSPHATE URIDYLYLTRANSFERASE FAMILY 1. Cosmid sequence is correct but there may be a frameshift mutation in this region which would allow the two ORFS to be joined. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, galT is split into 2 parts,galT' and 'galT. In Mycobacterium bovis, an in-frame insertion of a single base (*-a) leads to a single product. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 712781 | 713965 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0635|galT
MSATPPPGGLDASVFIANERGRQLDEALPVGFCVVTAPTRWTLADGRDLLFFSLPGHVPAPVSDRRPLPERDPAPSRLRFDRATGQWVIVAAQRQDRTYKPPAARCPLCPGPTGLSSEVPAPDYDVVVFENRFPSLAGAGIAPIGAPDGDGFVSAPGHGRCEVICFSADHTGSFAGLDPAHAGLVVHAWRHRTAELTALPGVAQVFCFENRGEEIGVTLTHPHGQIYAYPYLTPRTAAMLRQARRHRKRHGDNLFASLLAREVADGSRIVVRGELFTAFVPFAARWPVEVHIYPNRLVRNLTELNDGELDEFARIYLDVLQRFDRMYSSPLPYMSALHQFSEVQRDGYFHVELMSIRRSATKLKYLAAAESAMDAFIADVIPESVAARLRELGP
Bibliography
No article yet recorded