Gene Rv0619 ('galT)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in galactose metabolism (leloir pathway) [catalytic activity: UTP + alpha-D-galactose 1-phosphate = diphosphate + UDP-galactose]. |
| Product | Probable galactose-1-phosphate uridylyltransferase GalTb [second part] |
| Comments | Rv0619, (MTCY19H5.02c), len: 181 aa (probable partial CDS). Probable galTb, second part of galactose-1-phosphate uridylyltransferase, highly similar to C-terminal half of other galT proteins e.g. P13212|GAL7_STRLI galactose-1-phosphate uridylyltransferase from Streptomyces lividans (354 aa), FASTA scores: opt: 416, E(): 5.2e-22, (43.0% identity in 186 aa overlap), etc. Cosmid sequence is correct but there may be a frameshift mutation in this region which would allow the two ORFS to be joined. Belongs to the galactose-1-phosphate uridylyltransferase family 1. Note that previously known as 'galT. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 712174 | 712719 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0619|galTb
GDRGDPAHPHGQIYAYPYLTPRTAAMLRQARRHRKRHGDNLFASLLAREVADGSRIVVRGELFTAFVPFAARWPVEVHIYPNRLVRNLTELNDGELDEFARIYLDVLQRFDRMYSSPLPYMSALHQFSEVQRDGYFHVELMSIRRSATKLKYLAAAESAMDAFIADVIPESVATRLRELGP
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
