Gene Rv0621
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Possible membrane protein |
Comments | Rv0621, (MTCY20H10.02), len: 354 aa. Possible membrane protein; contains potential membrane spanning regions. Also contains PS00017 ATP/GTP-binding site motif A (P-loop). |
Functional category | Cell wall and cell processes |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 714202 | 715266 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0621|Rv0621 MAGDRGADPGPANVTPGADDHAQHASPTVLCPQGHVNAWDYRFCERCGSPIGVVPWPSEESGTRQTAPARSFVPLVVLAATLLVVAVVVTAVGYAVTRPARNDREEPSSARGAATTGVPFAQAEAASCPDDPVLEAESIDLTSDGLAVSAAFMSACAGGDVESNSALEVTVADGRRDVAAGSFDFSADPLRIEPGVPARRTLVFPPGMYWRTPDMLSGAPALAATRKGRSDRSAARGGSARTTMVAAASAAPAYGSINAVAGAVLVELRDSDFPYVRVGIANRWVPQVSSKRVGLVAAGKTWTSADILRDHLALRQRFGGARLVWSGHWTTFSGPDFWVTVVGPAQPTAAEANR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant