Gene Rv0622
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible membrane protein |
| Comments | Rv0622, (MTCY20H10.03), len: 315 aa. Possible membrane protein; contains potential membrane spanning region. Shows weak similarity with Mycobacterium tuberculosis hypothetical proteins Rv1804c, Rv1810, etc. Start changed since first submission (-26 aa). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 715370 | 716317 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0622|Rv0622
MSFCVYCGAELADPTRCGACGAYKIGSTWHRTTTPTVGAATTATGWRPDPTGRHEGRYFVAGQPTDLVREGDAEAVDPLGQQQLDQSGAVGVSPSAVSGWVRSGHRRLWWALAGVVAFLGLVGAGVVGTLFLNRDRESIDDKYLAALRRSGLTGEFNSDANAIARGKQVCRQLQDGGEQQGMPVDQVAVQYYCPQFSDGFHILETITVTGSFTLKDESPNVYAPAITVSGSGCSGSAGYADIDRGTQVTVKNGQGDILATAFLQAGQGGRFLCTFPFSFEITEGEDRYVVSVSRRGEMSYSFADLKANGLSLVLG
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant