Gene Rv0641
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | This protein binds directly to 23S ribosomal RNA and is located in the neighborhood of the site where elongation factor TU is bound to the ribosome. |
| Product | 50S ribosomal protein L1 RplA |
| Comments | Rv0641, (MTCY20H10.22), len: 235 aa. rplA, 50S ribosomal protein L1, equivalent to NP_302281.1|NC_002677 50S ribosomal protein L1 from Mycobacterium leprae (235 aa). Also highly similar to others e.g. P3625|RL1_STRGR 50s ribosomal protein L1 from Streptomyces griseus (240 aa), FASTA scores: opt: 1081, E(): 0, (72.2% identity in 230 aa overlap); etc. Belongs to the L1P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Identified by proteomics (See Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol and cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in both the aqueous and detergent phases of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE, CEGE, and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 735517 | 736224 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0641|rplA
MSKTSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERIQGGWLEFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINFRVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGIPVDPSITRNFAGE
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant