Gene Mb0660
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l1 rpla |
| Comments | Mb0660, rplA, len: 235 aa. Equivalent to Rv0641,len: 235 aa, from Mycobacterium tuberculosis strain H37Rv (99.6% identity in 235 aa overlap). Probable rplA, 50S ribosomal protein L1, equivalent to NP_302281.1|NC_002677 50S ribosomal protein L1 from Mycobacterium leprae (235 aa). Also highly similar to others e.g. P3625|RL1_STRGR 50s ribosomal protein L1 from Streptomyces griseus (240 aa), FASTA scores: opt: 1081, E(): 0, (72.2% identity in 230 aa overlap); etc. BELONGS TO THE L1P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 736753 | 737460 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0660|rplA
MSKTSKAYRAAAAKVDRTNLYTPLQAAKLAKETSSTKQDATVEVAIRLGVDPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKADAAVAAGADVVGSDDLIERIQGGWLEFDAAIAAPDQMAKVGRIARVLGPRGLMPNPKTGTVTADVAKAVADIKGGKINFRVDKQANLHFVIGKASFDEKLLAENYGAAIDEVLRLKPSSSKGRYLKKITVSTTTGPGIPVDPSITRNFAGE
Bibliography
No article yet recorded