Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in mycolic acids modification. Catalyzes unusual S-adenosyl-methionine-dependent transformation of a cis-olefin mycolic acid into a secondary alcohol. Catalyzes introduction of a hydroxyl group at the distal position on mycolic acid chains to produce the hydroxyl mycolate. Mycolic acids represent a major constituent of the mycobacterial cell wall complex. Methyl transfer results in formation of a secondary hydroxy group with an adjacent methyl branch; olefinic mycolic acid methyl transferase.
ProductMethoxy mycolic acid synthase 4 MmaA4 (methyl mycolic acid synthase 4) (MMA4) (hydroxy mycolic acid synthase)
CommentsRv0642c, (MTCY20H10.23c), len: 301 aa. MmaA4, methoxy mycolic acid synthase 4 (methyltransferase) (see citations below). Equivalent to AAC44876|AAC44876.1|cmaA methyl transferase (mycolic acid modification protein) from Mycobacterium bovis BCG strain Pasteur (298 aa); NP_302280.1|NC_002677 methyl mycolic acid synthase 4 from Mycobacterium leprae (298 aa); and highly similar to others from Mycobacteria e.g. downstream ORF P72027|mmaA3|Rv0643c|MTCY20H10.24c putative methoxy mycolic acid synthase 3 from Mycobacterium tuberculosis (293 aa). Phosphorylated in vitro by PknJ|Rv2088 (See Jang et al., 2010).
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS736298737203-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0642c|mmaA4
MTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA
      
Bibliography