Gene Rv0658c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown. Supposedly involved in stationary-phase survival. |
| Product | Probable conserved integral membrane protein |
| Comments | Rv0658c, (MTCI376.18), len: 238 aa. Probable conserved integral membrane protein, equivalent to a predicted homologous protein from Mycobacterium smegmatis (see citation below), and showing some similarity with P33774|YPRB_ECOLI hypothetical 24.3 kDa protein from Escherichia coli (217 aa), FASTA scores: opt: 174, E(): 5.3e-05, (25.6% identity in 223 aa overlap). Also similar to Rv1863c and Rv0804 from Mycobacterium tuberculosis. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 753693 | 754409 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0658c|Rv0658c
VEAGRADTVAPSHRWGLGAFLVVELVFLVASTSLAVVLTGHGPVSAGVLALALAAPTVVAAGLAILITRLRGNGLRTDLRLRWSWRGLRLGLMFGFGGMLVTIPASLVYTAIVGPEANSAVVRIFGGVRASWPWALVVFLVVVFVAPLCEEIIYRGLLWGAVDRRWGRWAALVVTTVVFALAHLEFARAPLLVVVAIPIALARFYSGGLLASIVTHQVTNLLPGIVLLLGLTGAISLP
Bibliography
- Keer J, Smeulders MJ, Gray KM and Williams HD [2000]. Mutants of Mycobacterium smegmatis impaired in stationary-phase survival. Homolog Mutant Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
