Gene Rv0666
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible membrane protein |
| Comments | Rv0666, (MTCI376.10c), len: 57 aa. Possible membrane protein; has hydrophobic stretch at aa 29-47. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Cell wall and cell processes |
| Mutant | essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) non essential gene by Himar1-based transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003) Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 759136 | 759309 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0666|Rv0666
VTPRTDEGAAAPCLMPDVTMPVKRGDARGALGVGPALFVVSVSSSLVRARSCRCTAD
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
