Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcriptional mechanism
ProductProbable transcriptional regulatory protein
CommentsRv0691c, (MTCY210.08c), len: 198 aa. Probable transcriptional regulator, highly similar to AAC77476.1|U17129 unknown protein from Rhodococcus erythropolis (185 aa); and showing similarity with putative regulatory proteins eg STMTCREP_1|TCMR_STRGA|P39885 tetracenomycin c transcriptional repressor from Streptomyces glaucescens (226 aa), FASTA scores: opt: 178, E(): 8.5e-06, (27.9% identity in 201 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop) and probable helix-turn helix motifs from aa 34-55 (Score 1100, +2.93 SD) and 151-172 (Score 1124, +3.02 SD).
Functional categoryRegulatory proteins
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS791070791666-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0691c|Rv0691c
MPHESRVGRRRSTTPHHISDVAIELFAAHGFTDVSVDDIARAAGIARRTLFRYYASKNAIPWGDFSTHLAQLQGLLDNIDSRIQLRDALRAALLAFNTFDESETIRHRKRMRVILQTPELQAYSMTMYAGWREVIAKFVARRSGGKTTDFMPQTVAWTMLGVALSAYEHWLRDESVSLTEALGAAFDVVGAGLDRLNQ