Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionProtein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA.
Product30S ribosomal protein S19 RpsS
CommentsRv0705, (MTCY210.24), len: 93 aa. rpsS, 30S ribosomal protein S19, equivalent to S36895 ribosomal protein S19 from Mycobacterium bovis (93 aa), FASTA scores: opt: 623, E(): 0, (98.9% identity in 93 aa overlap); and NP_302261.1|NC_002677 30S ribosomal protein S19 from Mycobacterium leprae (93 aa). Also highly similar to others e.g. CAB82074.1|AL161803 30S ribosomal protein S19 from Streptomyces coelicolor (93 aa); etc. Contains PS00323 Ribosomal protein S19 signature. Belongs to the S19P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis: possibly down-regulated by hrcA|Rv2374c, and down-regulated after 4h, 24h and 96h of starvation (see citations below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS803411803692+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0705|rpsS
MPRSLKKGPFVDEHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHIKDDRKSKRR