Gene Mb0725
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 30s ribosomal protein s19 rpss |
Comments | Mb0725, rpsS, len: 93 aa. Equivalent to Rv0705,len: 93 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 93 aa overlap). Probable rpsS, 30S ribosomal protein S19, equivalent to S36895 ribosomal protein S19 from Mycobacterium bovis (93 aa), FASTA scores: opt: 623, E(): 0, (98.9% identity in 93 aa overlap); and NP_302261.1|NC_002677 30S ribosomal protein S19 from Mycobacterium leprae (93 aa). Also highly similar to others e.g. CAB82074.1|AL161803 30S ribosomal protein S19 from Streptomyces coelicolor (93 aa); etc. Contains PS00323 Ribosomal protein S19 signature. BELONGS TO THE S19P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 805233 | 805514 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0725|rpsS MPRSLKKGPFVDEHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHIKDDRKSKRR
Bibliography
No article yet recorded