Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThis protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, E.G., L4, L17, and L20. It is important during the early stages of 50S reconstitution.
Product50S ribosomal protein L22 RplV
CommentsRv0706, (MTCY210.25), len: 197 aa. rplV, 50S ribosomal protein L22, equivalent to O06115|RL22_MYCSM 50S ribosomal protein L22 from Mycobacterium smegmatis (153 aa); MBS10OPER_7 50S ribosomal protein L22 from Mycobacterium bovis BCG; and MLCB2492_7 50S ribosomal protein L22 from Mycobacterium leprae (175 aa). Also highly similar to others e.g. CAB82075.1|AL161803 50S ribosomal protein L22 from Streptomyces coelicolor (125 aa); P42060|RL22_BACSU 50s ribosomal protein L22 from Bacillus subtilis (113 aa), FASTA scores: opt: 368, E(): 2.4e-13, (52.8% identity in 108 aa overlap); etc. Contains PS00464 Ribosomal protein L22 signature, and contains repetitive sequence at C-terminus. Belongs to the L22P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS803689804282+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0706|rplV
MTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKVIASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQGRAFRIRRRTSHITVVVESRPAKDQRSAKSSRARRTEASKAASKVGATAPAKKAAAKAPAKKAPASSGVKKTPAKKAPAKKAPAKASETSAAKGGSD
      
Bibliography