Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThis protein is found in the ribonucleoprotein core and is involved in the early assembly of the 50S subunit. It is not involved in the functions of the mature 50S subunit.
Product50S ribosomal protein L24 RplX
CommentsRv0715, (MTCY210.34), len: 105 aa. rplX, 50S ribosomal protein L24, equivalent to O32994|MLCB2492_15 50S ribosomal protein L24 from Mycobacterium leprae (105 aa). Also highly similar to others e.g. CAB82081.1|AL161803 50S ribosomal protein L24 from Streptomyces coelicolor (107 aa); P12876|RL24_BACSU 50s ribosomal protein L24 (bl23) from Bacillus subtilis (103 aa), FASTA scores: opt: 363, E(): 1.8e-18, (56.7% identity in 104 aa overlap); etc. Contains PS01108 Ribosomal protein L24 signature. Belongs to the L24P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis: possibly down-regulated by hspR|Rv0353, and down-regulated after 24h and 96h of starvation (see citations below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS811742812059+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0715|rplX
MKVHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLVEGVNRIKKHTAISTTQRGARSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRISKRNGKDI