Gene Mb0736
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l24 rplx |
| Comments | Mb0736, rplX, len: 105 aa. Equivalent to Rv0715,len: 105 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 105 aa overlap). Probable rplX, 50S ribosomal protein L24, equivalent to O32994|MLCB2492_15 50S RIBOSOMAL PROTEIN L24 from Mycobacterium leprae (105 aa). Also highly similar to others e.g. CAB82081.1|AL161803 50S ribosomal protein L24 from Streptomyces coelicolor (107 aa); P12876|RL24_BACSU 50s ribosomal protein L24 (bl23) from Bacillus subtilis (103 aa), FASTA scores: opt: 363, E(): 1.8e-18, (56.7% identity in 104 aa overlap); etc. Contains PS01108 Ribosomal protein L24 signature. BELONGS TO THE L24P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 813564 | 813881 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0736|rplX
MKVHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLVEGVNRIKKHTAISTTQRGARSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRISKRNGKDI
Bibliography
No article yet recorded