Gene Rv0715
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | This protein is found in the ribonucleoprotein core and is involved in the early assembly of the 50S subunit. It is not involved in the functions of the mature 50S subunit. |
| Product | 50S ribosomal protein L24 RplX |
| Comments | Rv0715, (MTCY210.34), len: 105 aa. rplX, 50S ribosomal protein L24, equivalent to O32994|MLCB2492_15 50S ribosomal protein L24 from Mycobacterium leprae (105 aa). Also highly similar to others e.g. CAB82081.1|AL161803 50S ribosomal protein L24 from Streptomyces coelicolor (107 aa); P12876|RL24_BACSU 50s ribosomal protein L24 (bl23) from Bacillus subtilis (103 aa), FASTA scores: opt: 363, E(): 1.8e-18, (56.7% identity in 104 aa overlap); etc. Contains PS01108 Ribosomal protein L24 signature. Belongs to the L24P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis: possibly down-regulated by hspR|Rv0353, and down-regulated after 24h and 96h of starvation (see citations below). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 811742 | 812059 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0715|rplX
MKVHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLVEGVNRIKKHTAISTTQRGARSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRISKRNGKDI
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant