Gene Rv0716
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | This is one of 3 proteins that mediate the attachment of the 5S RNA into the large ribosomal subunit. |
| Product | 50S ribosomal protein L5 RplE |
| Comments | Rv0716, (MTCY210.35), len: 187 aa. rplE, 50S ribosomal protein L5, equivalent to MLCB2492_16 50S ribosomal protein L5 from Mycobacterium leprae (187 aa). Also highly similar to others e.g. CAB82082.1|AL161803 50S ribosomal protein L5 from Streptomyces coelicolor (185 aa); P33098|RL5_MICLU 50S ribosomal protein L5 from Micrococcus luteus (191 aa), FASTA scores: opt: 930, E(): 0, (73.8% identity in 183 aa overlap); etc. Belongs to the L5P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Identified by proteomics (see Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE, CEGE, and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002). Note that in Mycobacterium bovis BCG, Northern blotting analysis and cDNA-totalRNA substractive hybridization strategy reveals increased expression of the corresponding transcript while inside macrophages (see Li et al., 2001). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 812059 | 812622 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0716|rplE
MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Li MS, Monahan IM, Waddell SJ, Mangan JA, Martin SL, Everett MJ and Butcher PD [2001]. cDNA-RNA subtractive hybridization reveals increased expression of mycocerosic acid synthase in intracellular Mycobacterium bovis BCG. Homolog Transcriptome
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
