Gene Mb0737
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l5 rple |
Comments | Mb0737, rplE, len: 187 aa. Equivalent to Rv0716,len: 187 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 187 aa overlap). Probable rplE, 50S ribosomal protein L5, equivalent to MLCB2492_16 50S RIBOSOMAL PROTEIN L5 from Mycobacterium leprae (187 aa). Also highly similar to others e.g. CAB82082.1|AL161803 50S ribosomal protein L5 from Streptomyces coelicolor (185 aa); P33098|RL5_MICLU 50S RIBOSOMAL PROTEIN L5 from Micrococcus luteus (191 aa), FASTA scores: opt: 930, E(): 0, (73.8% identity in 183 aa overlap); etc. BELONGS TO THE L5P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 813881 | 814444 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0737|rplE MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN
Bibliography
No article yet recorded