Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThis is one of 3 proteins that mediate the attachment of the 5S RNA into the large ribosomal subunit.
Product50S ribosomal protein L5 RplE
CommentsRv0716, (MTCY210.35), len: 187 aa. rplE, 50S ribosomal protein L5, equivalent to MLCB2492_16 50S ribosomal protein L5 from Mycobacterium leprae (187 aa). Also highly similar to others e.g. CAB82082.1|AL161803 50S ribosomal protein L5 from Streptomyces coelicolor (185 aa); P33098|RL5_MICLU 50S ribosomal protein L5 from Micrococcus luteus (191 aa), FASTA scores: opt: 930, E(): 0, (73.8% identity in 183 aa overlap); etc. Belongs to the L5P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified by proteomics (see Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE, CEGE, and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002). Note that in Mycobacterium bovis BCG, Northern blotting analysis and cDNA-totalRNA substractive hybridization strategy reveals increased expression of the corresponding transcript while inside macrophages (see Li et al., 2001).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS812059812622+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0716|rplE
MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN
      
Bibliography