Gene Rv0717 (rpsN)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Known to be required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the a site. |
| Product | 30S ribosomal protein S14 RpsN1 |
| Comments | Rv0717, (MTCY210.36), len: 61 aa. rpsN1, 30S ribosomal protein S14, equivalent to MLCB2492_17|O32996 ribosomal protein S14 from Mycobacterium leprae (61 aa). Also highly similar to others e.g. CAB82083.1|AL161803 30S ribosomal protein S14 from Streptomyces coelicolor (61 aa); P24320|RS14_THETH 30s ribosomal protein S14 from Thermus aquaticus (subsp. thermophilus) (60 aa), FASTA scores: opt: 316, E(): 2e-19,(70.0% identity in 60 aa overlap); etc. Contains PS00527 Ribosomal protein S14 signature. Belongs to the S14P family of ribosomal proteins. Note that previously known as rpsN. |
| Functional category | Information pathways |
| Proteomics | Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Regulon | Predicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).<EXISTING> Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 812627 | 812812 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0717|rpsN1
MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW
Bibliography
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
