Gene Mb0738
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 30s ribosomal protein s14 rpsn1 |
Comments | Mb0738, rpsN1, len: 61 aa. Equivalent to Rv0717,len: 61 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 61 aa overlap). Probable rpsN1, 30S ribosomal protein S14, equivalent to MLCB2492_17|O32996 RIBOSOMAL PROTEIN S14 from Mycobacterium leprae (61 aa). Also highly similar to others e.g. CAB82083.1|AL161803 30S ribosomal protein S14 from Streptomyces coelicolor (61 aa); P24320|RS14_THETH 30s ribosomal protein S14 from Thermus aquaticus (subsp. thermophilus) (60 aa), FASTA scores: opt: 316, E(): 2e-19,(70.0% identity in 60 aa overlap); etc. Contains PS00527 Ribosomal protein S14 signature. BELONGS TO THE S14P FAMILY OF RIBOSOMAL PROTEINS. Note that previously known as rpsN. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 814449 | 814634 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0738|rpsN1 MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW
Bibliography
No article yet recorded