Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionKnown to be required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the a site.
Product30S ribosomal protein S14 RpsN1
CommentsRv0717, (MTCY210.36), len: 61 aa. rpsN1, 30S ribosomal protein S14, equivalent to MLCB2492_17|O32996 ribosomal protein S14 from Mycobacterium leprae (61 aa). Also highly similar to others e.g. CAB82083.1|AL161803 30S ribosomal protein S14 from Streptomyces coelicolor (61 aa); P24320|RS14_THETH 30s ribosomal protein S14 from Thermus aquaticus (subsp. thermophilus) (60 aa), FASTA scores: opt: 316, E(): 2e-19,(70.0% identity in 60 aa overlap); etc. Contains PS00527 Ribosomal protein S14 signature. Belongs to the S14P family of ribosomal proteins. Note that previously known as rpsN.
Functional categoryInformation pathways
ProteomicsIdentified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
RegulonPredicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).<EXISTING>
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS812627812812+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0717|rpsN1
MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW