Gene Rv0726c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possible methyltransferase |
| Product | Possible S-adenosylmethionine-dependent methyltransferase |
| Comments | Rv0726c, (MTCY210.45c), len: 367 aa. Possible S-adenosylmethionine-dependent methyltransferase (see Grana et al., 2007), highly similar to other proteins from Mycobacterium tuberculosis e.g. Q10552|Y893_MYCTU|Rv0893c|MT0917|MTCY31.21c (325 aa), FASTA scores: opt: 646, E(): 0, (38.3% identity in 329 aa overlap); Rv0731c|MTV041.05c (318 aa), Rv3399, etc. Also similar to proteins from Mycobacterium leprae and other organisms e.g. T35930 hypothetical protein SC9B5.10 from Streptomyces coelicolor (303 aa). |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 818537 | 819640 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0726c|Rv0726c
MTYTGSIRCEGDTWDLASSVGATATMVAAARAMATRAANPLINDQFAEPLVRAVGVDVLTRLASGELTASDIDDPERPNASMVRMAEHHAVRTKFFDEFFMDATRAGIRQVVILASGLDSRAYRLAWPAQTVVYEIDQPQVMEFKTRTLAELGATPTADRRVVTADLRADWPTALGAAGFDPTQPTAWSAEGLLRYLPPEAQDRLLDNVTALSVPDSRFATESIRNFKPHHEERMRERMTILANRWRAYGFDLDMNELVYFGDRNEPASYLSDNGWLLTEIKSQDLLTANGFQPFEDEEVPLPDFFYVSARLQRKHRQYPAHRKPAPSWRHTACPVNELSKSAAYTMTRSDAHQASTTAPPPPGLTG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Graña M et al. [2007]. The crystal structure of M. leprae ML2640c defines a large family of putative S-adenosylmethionine-dependent methyltransferases in mycobacteria. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
