Gene Mb0747c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible s-adenosylmethionine-dependent methyltransferase |
| Comments | Mb0747c, -, len: 367 aa. Equivalent to Rv0726c,len: 367 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 367 aa overlap). Conserved hypothetical protein, highly similar to other conserved hypothetical proteins from Mycobacterium tuberculosis e.g. Q10552|Y893_MYCTU|Rv0893c|MT0917|MTCY31.21c (325 aa),FASTA scores: opt: 646, E(): 0, (38.3% identity in 329 aa overlap); Rv0731c|MTV041.05c (318 aa), Rv3399, etc. Also similar to proteins from Mycobacterium leprae and other organisms e.g. T35930 hypothetical protein SC9B5.10 from Streptomyces coelicolor (303 aa). |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 820359 | 821462 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0747c|Mb0747c
MTYTGSIRCEGDTWDLASSVGATATMVAAARAMATRAANPLINDQFAEPLVRAVGVDVLTRLASGELTASDIDDPERPNASMVRMAEHHAVRTKFFDEFFMDATRAGIRQVVILASGLDSRAYRLAWPAQTVVYEIDQPQVMEFKTRTLAELGATPTADRRVVTADLRADWPTALGAAGFDPTQPTAWSAEGLLRYLPPEAQDRLLDNVTALSVPDSRFATESIRNFKPHHEERMRERMTILANRWRAYGFDLDMNELVYFGDRNEPASYLSDNGWLLTEIKSQDLLTANGFQPFEDEEVPLPDFFYVSARLQRKHRQYPAHRKPAPSWRHTACPVNELSKSAAYTMTRSDAHQASTTAPPPPGLTG
Bibliography
No article yet recorded
