Gene Rv0727c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in fucose metabolism (at the third step) [catalytic activity: L-fuculose 1-phosphate = glycerone phosphate + (S)-lactaldehyde]. |
| Product | Possible L-fuculose phosphate aldolase FucA (L-fuculose-1-phosphate aldolase) |
| Comments | Rv0727c, (MTV41.01c, MTCY210.46c), len: 218 aa. Possible fucA, L-fuculose-1-phosphate aldolase, similar to many e.g. NP_386339.1|NC_003047 putative L-fuculose phosphate aldolase protein from Sinorhizobium meliloti (222 aa); P11550|FUCA_ECOLI L-fuculose phosphate aldolase from Escherichia strain K12 (215 aa), FASTA scores: opt: 372, E(): 4.1e-19, (34.6% identity in 185 aa overlap); etc. Belongs to the aldolase class II family, ARAD/FUCA subfamily. Cofactor: binds one zinc ion per molecule. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 819843 | 820499 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0727c|fucA
MNFVDAPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant