Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in fucose metabolism (at the third step) [catalytic activity: L-fuculose 1-phosphate = glycerone phosphate + (S)-lactaldehyde].
ProductPossible L-fuculose phosphate aldolase FucA (L-fuculose-1-phosphate aldolase)
CommentsRv0727c, (MTV41.01c, MTCY210.46c), len: 218 aa. Possible fucA, L-fuculose-1-phosphate aldolase, similar to many e.g. NP_386339.1|NC_003047 putative L-fuculose phosphate aldolase protein from Sinorhizobium meliloti (222 aa); P11550|FUCA_ECOLI L-fuculose phosphate aldolase from Escherichia strain K12 (215 aa), FASTA scores: opt: 372, E(): 4.1e-19, (34.6% identity in 185 aa overlap); etc. Belongs to the aldolase class II family, ARAD/FUCA subfamily. Cofactor: binds one zinc ion per molecule.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS819843820499-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0727c|fucA
MNFVDAPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLVDAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL