Gene Rv0741
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Required for the transposition of the insertion element IS1557. |
| Product | Probable transposase (fragment) |
| Comments | Rv0741, (MTV041.15), len: 104 aa. Probable truncated transposase for IS1557, showing similarity to transposases and is elements e.g. U63997|EFU63997_1 insertion sequence from Enterococcus faecium (424 aa), FASTA score: (31.0% identity in 87 aa overlap). Very high similarity with the C-terminal part of Z73419|MTCY373_3 2 IS1557 from Mycobacterium tuberculosis (444 aa), FASTA score: (86.5% identity in 104 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 832534 | 832848 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0741|Rv0741
VFSVKGEEGKQALDRWISWARRCRIPVFVELAGGIVRHRQAIDAALDHGLWQGLIESTNTKIRLLTRIAFGFRSPEALIALAMLALGGRRPALPGRTKHPRISQ
Bibliography
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant