Gene Mb0762
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable transposase (fragment) |
| Comments | Mb0762, -, len: 104 aa. Equivalent to Rv0741, len: 104 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 104 aa overlap). Probable truncated transposase for IS1557, showing similarity to transposases and IS elements e.g. U63997|EFU63997_1 insertion sequence from Enterococcus faecium (424 aa), FASTA score: (31.0% identity in 87 aa overlap). Very high similarity with the C-terminal part of Z73419|MTCY373_3 2 IS1557 from Mycobacterium tuberculosis (444 aa), FASTA score: (86.5% identity in 104 aa overlap). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 834358 | 834672 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0762|Mb0762
MFSVKGEEGKQALDRWISWARRCRIPVFVELAGGIVRHRQAIDAALDHGLWQGLIESTNTKIRLLTRIAFGFRSPEALIALAMLALGGRRPALPGRTKHPRISQ
Bibliography
No article yet recorded