Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPlays a role in valine and pyrimidine metabolism. Binds fatty acyl-CoA [catalytic activity: 2-methyl-3-oxopropanoate + CoA + NAD+ = propanoyl-CoA + CO2 + NADH].
ProductProbable methylmalonate-semialdehyde dehydrogenase MmsA (methylmalonic acid semialdehyde dehydrogenase) (MMSDH)
CommentsRv0753c, (MTV041.27c), len: 510 aa. Probable mmsA, methylmalonic acid semialdehyde dehydrogenase, highly similar to others e.g. NP_420115.1|NC_002696 putative methylmalonate-semialdehyde dehydrogenase from Caulobacter crescentus (499 aa); L48550|STMMSDA_1|CAB75315.1|AL139164 methylmalonic acid semialdehyde dehydrogenase from Streptomyces coelicolor (500 aa), FASTA score: (51.6% identity in 498 aa overlap); M84911|PSEMMSRAB_2|NP_252260.1|NC_002516 methylmalonate-semialdehyde dehydrogenase from Pseudomonas aeruginosa (497 aa), FASTA scores: opt: 1127, E(): 0, (47.9% identity in 507 aa overlap); etc. Note that also highly similar to malonic semialdehyde oxidative decarboxylases e.g. NP_104968.1|NC_002678 malonic semialdehyde oxidative decarboxylase from Mesorhizobium loti (498 aa); NP_384832.1|NC_003047 putative malonic semialdehyde oxidative decarboxylase protein from Sinorhizobium meliloti (498 aa); etc. Contains PS00070 Aldehyde dehydrogenases cysteine active site. Belongs to the aldehyde dehydrogenases family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics (see Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis and up-regulated at high temperatures (see Stewart et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS844421845953-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0753c|mmsA
MTTQISHFIDGQRTAGQSTRSADVFDPNTGQIQAKVPMAGKSDIDAAVASAVEAQKGWAAWNPQRRARVLMRFIELVNDTIDELAELLSREHGKTLADARGDVQRGIEVIEFCLGIPHLLKGEYTEGAGPGIDVYSLRQPLGVVAGITPFNFPAMIPLWKAGPALACGNAFVLKPSERDPSVPVRLAELFIEAGLPAGVFQVVHGDKEAVDAILHHPDIKAVGFVGSSDIAQYIYAGAAATGKRAQCFGGAKNHMIVMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGDQTAERLRARLIERINNLRVGHSLDPKADYGPLVTGAALARVRDYIGQGVAAGAELVVDGRDRASDDLTFGLPEGDANLEGGFFIGPTLFDHVAAHMSIYTDEIFGPVLCMVRARDYEEALRLPSEHEYGNGVAIFTRDGDAARDFVSRVQVGMVGVNVPIPVPVAYHTFGGWKRSGFGDLNQHGPAAIQFYTKVKTVTSRWPSGIKDGAEFVIPTMS
      
Bibliography