Gene Rv0758
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Sensor part of a two component regulatory system. This protein is thought to be a sensor kinase for the phosphate regulon. Transcription of this operon is positively regulated by PHOB|Rv0757 and PHOR when phosphate is limited. |
| Product | Possible two component system response sensor kinase membrane associated PhoR |
| Comments | Rv0758, (MTCY369.03), len: 485 aa. Possible phoR, two component system response phosphate sensor kinase membrane-associated, highly similar to various sensor kinases e.g. CAC32361.1|AL583945 putative two component system histidine kinase from Streptomyces coelicolor (524 aa); NP_349365.1|NC_003030 Membrane-associated sensory histidine kinase with HAMP domain from Clostridium acetobutylicum (482 aa); and similar to phoP proteins e.g. NP_372216.1|NC_002758 alkaline phosphatase synthesis sensor protein from Staphylococcus aureus (554 aa); P23545|PHOR_BACSU alkaline phosphatase synthesis sensor from Bacillus subtilis (579 aa), FASTA scores: opt: 515, E(): 1.9e-25, (40.0% identity in 230 aa overlap); etc. Also similar to proteins from Mycobacterium tuberculosis e.g. MTCY20G9.16 FASTA scores: (34.5% identity in 264 aa overlap), MTU88959_2 (509 aa), MTCY10G2_17, etc. |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Operon | Rv0757 and Rv0758 are co-transcribed, by RT-PCR (See Gonzalo-Asensio et al., 2008). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). phoPR-locus mutant is attenuated in mice and in human and murine macrophages and has impaired synthesis of methyl-branched fatty acid-containing acyltrehaloses (See Perez et al., 2001; Gonzalo Asensio et al., 2006; Walters et al., 2006). PhoP but not PhoR is required for synthesis of methyl-branched fatty acid-containing acyltrehaloses (See Gonzalo Asensio et al., 2006). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 852396 | 853853 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0758|phoR
MARHLRGRLPLRVRLVAATLILVATGLVASGIAVTSMLQHRLTSRIDRVLLEEAQIWAQITLPLAPDPYPGHNPDRPPSRFYVRVISPDGQSYTALNDNTAIPAVPANNDVGRHPTTLPSIGGSKTLWRAVSVRASDGYLTTVAIDLADVRSTVRSLVLLQVGIGSAVLVVPGVAGYAVVRRSLRPLAEFEQTAAAIGAGQLDRRVPQWHPRTEVGRLSLALNGMLAQIQRAVASAESSAEKARDSEDRMRQFITDASHELRTPLTTIRGFAELYRQGAARDVGMLLSRIESEASRMGLLVDDLLLLARLDAHRPLELCRVDLLALASDAAHDARAMDPKRRITLEVLDGPGTPEVLGDESRLRQVLRNLVANAIQHTPESADVTVRVGTEGDDAILEVADDGPGMSQEDALRVFERFYRADSSRARASGGTGLGLSIVDSLVAAHGGAVTVTTALGEGCCFRVSLPRVSDVDQLSLTPVVPGPP
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gonzalo Asensio J, Maia C, Ferrer NL, Barilone N, Laval F, Soto CY, Winter N, Daffe M, Gicquel B, Martin C and Jackson M [2006]. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mutant
- Gonzalo-Asensio J et al. [2008]. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. Operon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
