Gene Rv0771
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in aromatic hydrocarbons catabolism. Thought to be involved in the catabolism of protocatechuate to succinate-and acetyl-CoA in the beta-ketoadipate pathway (at the third step) [catalytic activity: 2-carboxy-5-oxo-2,5-dihydrofuran-2-acetate = 5-oxo-4,5-dihydrofuran-2-acetate + CO(2)]. |
| Product | Possible 4-carboxymuconolactone decarboxylase (CMD) |
| Comments | Rv0771, (MTCY369.16), len: 144 aa. Possible 4-carboxymuconolactone decarboxylase, showing similarity with other carboxymuconolactone decarboxylases e.g. AAD39557.1|AF031417 PcaC-like protein from Pseudomonas putida (130 aa); P20370|DC4C_ACICA 4-carboxymuconolactone decarboxylase (CMD) from Acinetobacter sp. ADP1 (134 aa), FASTA scores: opt: 174, E(): 0.00075, (31.4% identity in 121 aa overlap); C-terminus of NP_421214.1|NC_002696 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase from Caulobacter crescentus (393 aa); C-terminus of T47115 probable 4-carboxymuconolactone decarboxylase / 3-oxoadipate enol-lactone hydrolase from Streptomyces sp (373 aa); NP_407104.1|NC_003143 putative gamma carboxymuconolactone decarboxylase from Yersinia pestis (131 aa); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 864140 | 864574 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0771|Rv0771
MMDELRRTGLDKMNEVYAWDMPDMPGEFFALTVDHLFGRIWTRPGLSMRDRRMAVIAVLTAQGQSDLLEVQVNAVLHNDELTIDELRELAVFITHYVGFPLGSRLNSAIERVAAKRKQAAENGSLPDTKANVAEVLAKESGKSS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
