Gene Rv0780
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in de novo purine biosynthesis (at the seventh step) [catalytic activity: ATP + 1-(5-phosphoribosyl)-4-carboxy-5-aminoimidazole + L-aspartate = ADP + phosphate + 1-(5-phosphoribosyl)-4-(N-succino-carboxamide)-5-aminoimidazole]. |
| Product | Phosphoribosylaminoimidazole- succinocarboxamide synthase PurC (SAICAR synthetase) |
| Comments | Rv0780, (MTCY369.24), len: 297 aa. PurC, phosphoribosylaminoimidazole- succinocarboxamide synthase (see citations below), equivalent to MTU34957_1|PURC phosphoribosylaminoimidazole-succinocarboxamide synthase from Mycobacterium leprae (297 aa), FASTA scores: opt: 1986, E(): 0, (99.3% identity in 297 aa overlap). Also similar to others e.g. CAB56351.1|AL118514 phosphoribosylaminoimidazole-succinocarboxamide synthase from Streptomyces coelicolor (299 aa); etc. Contains PS01058 SAICAR synthetase signature 2. Belongs to the SAICAR synthetase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 873343 | 874236 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0780|purC
MRPALSDYQHVASGKVREIYRVDDEHLLLVASDRISAYDYVLDSTIPDKGRVLTAMSAFFFGLVDAPNHLAGPPDDPRIPDEVLGRALVVRRLEMLPVECVARGYLTGSGLLDYQATGKVCGIALPPGLVEASRFATPLFTPATKAALGDHDENISFDRVVEMVGALRANQLRDRTLQTYVQAADHALTRGIIIADTKFEFGIDRHGNLLLADEIFTPDSSRYWPADDYRAGVVQTSFDKQFVRSWLTGSESGWDRGSDRPPPPLPEHIVEATRARYINAYERISELKFDDWIGPGA
Bibliography
- Jackson M, Berthet FX, Otal I, Rauzier J, Martin C, Gicquel B and Guilhot C [1996]. The Mycobacterium tuberculosis purine biosynthetic pathway: isolation and characterization of the purC and purL genes. Sequence
- Mulder MA et al. [1997]. Mycobacterial promoters. Review Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant