Gene Rv0781 (ptrBb)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Cleaves peptide bonds on the C-terminal side of lysyl and argininyl residues [catalytic activity: hydrolysis of ARG-|-XAA and LYS-|-XAA bonds in oligopeptides, even when P1' residue is proline]. |
| Product | Probable protease II PtrBa [first part] (oligopeptidase B) |
| Comments | Rv0781, (MTCY369.25), len: 236 aa. Probable ptrBa, first part of protease II, equivalent to N-terminus of NP_302455.1|NC_002677 protease II from Mycobacterium leprae (724 aa). Also highly similar to N-termini of many proteases II e.g. P24555|PTRB_ECOLI|TLP|B1845 protease II from Escherichia coli strains K12 and HB101 (707 aa), FASTA scores: opt: 204, E(): 7.4e-07, (29.6% identity in 230 aa overlap); etc. ORFs Rv0782 and Rv0781 appear to be a frameshifted homologues of protease II, but we can find no error in the cosmid sequence to account for this. Belongs to peptidase family S9A; also known as the prolyl oligopeptidase family. Note that previously known as ptrBb. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 874233 | 874943 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0781|ptrBa
MMHRTALPSPPVAKRVQTRREHHGDVFVDPYEWLRDKDSPEVIAYLEAENDYTERTTAHLEPLRQKIFHEIKARTKETDLSVPTRRGNWWYYARTFEGKQYGVHCRCPVTDPDDWNPPEFDERTEIPGEQLLLDENVEADGHDFFALGAASVSLDDNLLAYSVDVVGDERYTLRFKDLRTGEQYPDEIAGIGAGVTWAADNHCLLHHRGRGLASGHSVAIPTRVRRIVGAGLPRSR
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Ribeiro-Guimarães ML et al. [2007]. Comparative genomics of mycobacterial proteases. Homology
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
