Gene Rv0788
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in de novo purine biosynthesis (at the fourth step) [catalytic activity: ATP + 5'-phosphoribosylformylglycinamide + L-glutamine + H2O = ADP + phosphate + 5'-phosphoribosylformylglycinamidine + L-glutamate]. |
| Product | Probable phosphoribosylformylglycinamidine synthase I PURG (FGAM synthase I) |
| Comments | Rv0788, (MTCY369.32), len: 224 aa. Probable purQ, phosphoribosylformylglycinamidine synthase I, equivalent to MLCB5_24|Z95151|O05756|PURQ phosphoribosylformylglycinamidine synthase I from Mycobacterium leprae (224 aa), FASTA scores: opt: 1341, E(): 0, (88.7% identity in 222 aa overlap). Also highly similar to others e.g. P12041|PURQ_BACSU phosphoribosylformylglycinamidine synthase I from Bacillus subtilis (227 aa), FASTA scores: opt: 691, E(): 8.6e-39, (47.7% identity in 214 aa overlap); etc. Contains PS00442 Glutamine amidotransferases class-I active site. Belongs to type-1 glutamine amidotransferases. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 882760 | 883434 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0788|purQ
VTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant