Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in de novo purine biosynthesis (at the fourth step) [catalytic activity: ATP + 5'-phosphoribosylformylglycinamide + L-glutamine + H2O = ADP + phosphate + 5'-phosphoribosylformylglycinamidine + L-glutamate].
ProductProbable phosphoribosylformylglycinamidine synthase I PURG (FGAM synthase I)
CommentsRv0788, (MTCY369.32), len: 224 aa. Probable purQ, phosphoribosylformylglycinamidine synthase I, equivalent to MLCB5_24|Z95151|O05756|PURQ phosphoribosylformylglycinamidine synthase I from Mycobacterium leprae (224 aa), FASTA scores: opt: 1341, E(): 0, (88.7% identity in 222 aa overlap). Also highly similar to others e.g. P12041|PURQ_BACSU phosphoribosylformylglycinamidine synthase I from Bacillus subtilis (227 aa), FASTA scores: opt: 691, E(): 8.6e-39, (47.7% identity in 214 aa overlap); etc. Contains PS00442 Glutamine amidotransferases class-I active site. Belongs to type-1 glutamine amidotransferases.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS882760883434+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0788|purQ
VTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG