Gene Rv0793
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Possible monooxygenase |
| Comments | Rv0793, (MTV042.03), len: 101 aa. Possible monooxygenase (See Lemieux et al., 2005). Similar to e.g. NP_250888.1|NC_002516 hypothetical protein from Pseudomonas aeruginosa (114 aa); AE 001908|AE001908_7 hypothetical protein from Deinococcus radiodurans (101 aa), FASTA scores: opt: 215, E(): 3.1e-09, (40.4% identity in 99 aa overlap); NP_440966.1|NC_000911|D90908|PCC6803|D90908_2 unknown protein from Synechocystis sp. strain PCC 6803 (147 aa), FASTA scores: opt: 194, E(): 4.5e-08, (31.1% identity in 90 aa overlap); etc. Also similar to Rv2749|MTV002.14|AL0089|MTV002_15 conserved hypothetical protein from Mycobacterium tuberculosis (104 aa), FASTA scores: opt: 143, E(): 0.00026, (26.9% identity in 93 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 886719 | 887024 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0793|Rv0793
MTSPVAVIARFMPRPDARSALRALLDAMITPTRAEDGCRSYDLYESADGGELVLFERYRSRIALDEHRGSPHYLNYRAQVGELLTRPVAVTVLAPLDEASA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lemieux MJ et al. [2005]. The crystal structure of Rv0793, a hypothetical monooxygenase from M. tuberculosis. structure
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
