Gene Mb0817
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible monooxygenase |
Comments | Mb0817, -, len: 101 aa. Equivalent to Rv0793, len: 101 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 101 aa overlap). Conserved hypothetical protein, similar to others e.g. NP_250888.1|NC_002516 hypothetical protein from Pseudomonas aeruginosa (114 aa); AE 001908|AE001908_7 hypothetical protein from Deinococcus radiodurans (101 aa), FASTA scores: opt: 215, E(): 3.1e-09, (40.4% identity in 99 aa overlap); NP_440966.1|NC_000911|D90908|PCC6803|D90908_2 unknown protein from Synechocystis sp. strain PCC 6803 (147 aa),FASTA scores: opt: 194, E(): 4.5e-08, (31.1% identity in 90 aa overlap); etc. Also similar to Rv2749|MTV002.14|AL0089|MTV002_15 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (104 aa), FASTA scores: opt: 143, E(): 0.00026, (26.9% identity in 93 aa overlap). |
Functional category | Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 888909 | 889214 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0817|Mb0817 MTSPVAVIARFMPRPDARSALRALLDAMITPTRAEDGCRSYDLYESADGGELVLFERYRSRIALDEHRGSPHYLNYRAQVGELLTRPVAVTVLAPLDEASA
Bibliography
No article yet recorded