Gene Rv0814c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in sulphur metabolism. |
| Product | Conserved protein SseC2 |
| Comments | Rv0814c, (MTV043.06c, O05794), len: 100 aa. SseC2, conserved protein, highly similar to AAA62972.1|U15182|MLU15182_17 hypothetical protein from Mycobacterium leprae (143 aa), FASTA scores: opt: 545, E(): 0, (84.0% identity in 100 aa overlap); and NP_302441.1|NC_002677|Z95150|MTCY164_29 conserved hypothetical protein from Mycobacterium leprae (100 aa), FASTA scores: opt: 647, E(): 0, (100.0% identity in 100 aa overlap). Also highly similar to M29612|SERCYSA_5 rhodanese-like protein from Saccharopolyspora erythraea (101 aa), FASTA scores: opt: 345, E(): 1.2e-18, (57.1% identity in 98 aa overlap); and similar at the C-terminus to the C-terminus of CAB94069.1|AL358692 conserved hypothetical protein from Streptomyces coelicolor (95 aa). Identical second copy present as Rv3118|MTCY164.28|SSEC1 from Mycobacterium tuberculosis (100 aa) (100.0% identity in 100 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 908181 | 908483 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0814c|sseC2
MCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFTAEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIT
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
