Gene Mb0837c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein ssec2 |
| Comments | Mb0837c, sseC2, len: 100 aa. Equivalent to Rv0814c,len: 100 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 100 aa overlap). sseC2, conserved hypothetical protein, highly similar to AAA62972.1|U15182|MLU15182_17 hypothetical protein from Mycobacterium leprae (143 aa), FASTA scores: opt: 545,E(): 0, (84.0% identity in 100 aa overlap); and NP_302441.1|NC_002677|Z95150|MTCY164_29 conserved hypothetical protein from Mycobacterium leprae (100 aa),FASTA scores: opt: 647, E(): 0, (100.0% identity in 100 aa overlap). Also highly similar to M29612|SERCYSA_5 rhodanese-like protein from Saccharopolyspora erythraea (101 aa), FASTA scores: opt: 345, E(): 1.2e-18, (57.1% identity in 98 aa overlap); and similar at the C-terminus to the C-terminus of CAB94069.1|AL358692 conserved hypothetical protein from Streptomyces coelicolor (95 aa). Identical second copy present as Rv3118|MTCY164.28|SSEC1 from Mycobacterium tuberculosis (100 aa) (100.0% identity in 100 aa overlap). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 909011 | 909313 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0837c|sseC2
MCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFTAEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIT
Bibliography
No article yet recorded