Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionMay be a sulfotransferase involved in the formation of thiosulfate [catalytic activity: thiosulfate + cyanide = sulfite + thiocyanate].
ProductProbable thiosulfate sulfurtransferase CysA2 (rhodanese-like protein) (thiosulfate cyanide transsulfurase) (thiosulfate thiotransferase)
CommentsRv0815c, (MTV043.07c, MT0837, O05793), len: 277 aa. Probable cysA2 (alternate gene name: sseC4), thiosulfate sulfurtransferase (see Wooff et al., 2002), equivalent to Q50036|CYSA|CYSA3|ML2198|THTR_MYCLE putative sulfurtransferase thiosulfate from Mycobacterium leprae (277 aa). Also highly similar to other putative thiosulfate sulfurtransferases e.g. P16385|THTR_SACER putative thiosulfate sulfurtransferase from Saccharopolyspora erythraea (Streptomyces erythraeus) (281 aa); NP_293941.1|NC_001263 thiosulfate sulfurtransferase from Deinococcus radiodurans (286 aa); etc. Identical second copy present as Rv3117|MTCY164.27|MT3199|O05793|cysA3 (277 aa) (100.0% identity in 277 aa overlap). Contains PS00683 Rhodanese C-terminal signature at C-terminus. Belongs to the rhodanese family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and possibly identified in two-dimensional gel electrophoresis and by mass spectrometry in standing cultures (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cytosol and cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS908485909318-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0815c|cysA2
MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS
      
Bibliography