Gene Rv0818
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Transcriptional regulatory protein |
| Comments | Rv0818, (MTV043.10), len: 255 aa. Probable transcriptional regulatory protein, highly similar to Q05943|GLNR_STRCO|L03213|STMGLNR_1|SCD84.26c transcriptional regulatory protein from Streptomyces coelicolor (267 aa), FASTA scores: opt: 945, E(): 0, (61.5 identity in 239 aa overlap); and similar to others from other organisms. Also similar to Rv2884|MTCY274.15|Z74024 from Mycobacterium tuberculosis (252 aa), FASTA scores: opt: 662, E(): 0, (47.8% identity in 226 aa overlap). |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 910972 | 911739 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0818|Rv0818
LLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDARNDLSSGRGLCRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLLSTGPAEIDARLRLVVGRRGDLADQESLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFELLKYLAQHAGRVFTRAQLLHEVWGYDFFGGTRTVDVHVRRLRAKLGPEHEALIGTVRNVGYKAVRPARGRPPAADPDDEDADPGRDGMQEPLVDPLRSQ
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
