Gene Rv0828c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in deamination of specific substrate. |
| Product | Possible deaminase |
| Comments | Rv0828c, (MTV043.20c), len: 140 aa. Possible deaminase, with its N-terminus highly similar to middle part of NP_302602.1|NC_002677 possible cytidine/deoxycytidylate deaminase from Mycobacterium leprae (171 aa). Also similar to other deaminases e.g. CAC18715.2|AL451182 putative deaminase from Streptomyces coelicolor (167 aa); NP_251189.1|NC_002516 probable deaminase from Pseudomonas aeruginosa (151 aa); NP_108387.1|NC_002678 nitrogen fixation protein gene from Mesorhizobium loti (149 aa); etc. Also similar to many conserved hypothetical proteins e.g. NP_389200.1|NC_000964 hypothetical protein from Bacillus subtilis (156 aa), FASTA scores: E(): 1.3e-07, (38.9% identity in 95 aa overlap); etc. And similar to Rv3752c possible deaminase from Mycobacterium tuberculosis. Contains PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature. Belongs to the cytidine and deoxycytidylate deaminases family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 921191 | 921613 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0828c|Rv0828c
MPAGMAGFRRWAQTNDPTAHAESLAIRAACTKLGTEHLVGTTLNVLAHPCPMCYGSLYYCSPDEVVFLTSRDAYEPHYVDDRRYFEPATFYDEFAKEWQDRRLPMRQEHRPDIRAGAVDVYRFRQEPNGGERSAIAAPTG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
