Gene Mb0851c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE DEAMINASE |
| Comments | Mb0851c, -, len: 140 aa. Equivalent to Rv0828c,len: 140 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 140 aa overlap). Possible deaminase (EC 3.5.-.-), with its N-terminus highly similar to middle part of NP_302602.1|NC_002677 possible cytidine/deoxycytidylate deaminase from Mycobacterium leprae (171 aa). Also similar to other deaminases e.g. CAC18715.2|AL451182 putative deaminase from Streptomyces coelicolor (167 aa); NP_251189.1|NC_002516 probable deaminase from Pseudomonas aeruginosa (151 aa); NP_108387.1|NC_002678 nitrogen fixation protein gene from Mesorhizobium loti (149 aa); etc. Also similar to many conserved hypothetical proteins e.g. NP_389200.1|NC_000964 hypothetical protein from Bacillus subtilis (156 aa),FASTA scores: E(): 1.3e-07, (38.9% identity in 95 aa overlap); etc. And similar to Rv3752c possible deaminase from Mycobacterium tuberculosis. Contains PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature. BELONGS TO THE CYTIDINE AND DEOXYCYTIDYLATE DEAMINASES FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 922021 | 922443 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0851c|Mb0851c
MPAGMAGFRRWAQTNDPTAHAESLAIRAACTKLGTEHLVGTTLNVLAHPCPMCYGSLYYCSPDEVVFLTSRDAYEPHYVDDRRYFEPATFYDEFAKEWQDRRLPMRQEHRPDIRAGAVDVYRFRQEPNGGERSAIAAPTG
Bibliography
No article yet recorded
