Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable lipoprotein LpqS
CommentsRv0847, (MTV043.40), len: 130 aa. Probable lpqS, lipoprotein. Contains possible signal sequence and PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
Functional categoryCell wall and cell processes
TranscriptomicsDNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS944343944735+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0847|lpqS
VVWMRSAIVAVALGVTVAAVAAACWLPQLHRHVAHPNHPLTTSVGSEFVINTDHGHLVDNSMPPCPERLATAVLPRSATPVLLPDVVAAAPGMTAALTDPVAPAARGPPAAQGSVRTGQDLLTRFCLARR