Gene Rv0856
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0856, (MTV043.49), len: 134 aa. Conserved hypothetical protein, showing weak similarity with NP_301674.1| (NC_002677) conserved hypothetical protein from Mycobacterium leprae (144 aa); and SC6G10.02c|T35511 hypothetical protein from Streptomyces coelicolor (144 aa). Also highly similar to other proteins from Mycobacterium tuberculosis e.g. neighbouring ORF downstream Rv0857 conserved hypothetical protein (126 aa), FASTA scores: E(): 7.4e-27, (62.0% identity in 100 aa overlap); neighbouring ORF Rv0854|MTV043_47 conserved hypothetical protein (147 aa), FASTA scores: E(): 1.6e-15, (36.6% identity in 123 aa overlap), MTCI28.04|Z97050|MTCI28_4 (184 aa), FASTA scores: opt: 127, E(): 0.036, (26.0% identity in 127 aa overlap); and MLCL622.27c|Z95398 (156 aa), FASTA scores: opt: 123, E(): 0.06, (26.4% identity in 125 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 952825 | 953229 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0856|Rv0856
MEALADVGVLASWSPLHKQVEVIDYYPDGRPHHVRATVKILGLVDKEVLEYHWGPDWVCWDADQTFQQHGQHIEYTVKPEGVDRARVRFDITVEPAGPIPGFIVKRASEHVLDAAAKGLQKLIAGAGDQGNAKS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
